SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000019860 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000019860
Domain Number 1 Region: 118-172
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 0.000000000000116
Family B-box zinc-binding domain 0.00015
Further Details:      
 
Domain Number 2 Region: 17-114
Classification Level Classification E-value
Superfamily RING/U-box 0.000000000000148
Family RING finger domain, C3HC4 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000019860   Gene: ENSMLUG00000025984   Transcript: ENSMLUT00000027312
Sequence length 172
Comment pep:novel scaffold:Myoluc2.0:AAPE02068365:1142:5535:-1 gene:ENSMLUG00000025984 transcript:ENSMLUT00000027312 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSASLNYKSFSKEQQTMDNLEKQLICPICLEMFTKPVVILPCQHNLCRKCASDIFQQEQA
SNPYLPTRGGTTVASGGRFRCPSCRHEVVLDRHGIYGLQRNLLVENIIDIYKQESTRPEK
KSDQPRCEEHEEERINIYCLNCEVPTCSLCKIFGAHKDCQVAPLTHVFQRQK
Download sequence
Identical sequences G1Q827
ENSMLUP00000019860 ENSMLUP00000019860

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]