SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000019916 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000019916
Domain Number 1 Region: 30-76
Classification Level Classification E-value
Superfamily Elafin-like 0.00000000000301
Family Elafin-like 0.0012
Further Details:      
 
Domain Number 2 Region: 82-131
Classification Level Classification E-value
Superfamily Elafin-like 0.0000000000183
Family Elafin-like 0.00069
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000019916   Gene: ENSMLUG00000027708   Transcript: ENSMLUT00000024999
Sequence length 131
Comment pep:novel scaffold:Myoluc2.0:GL429857:3692955:3694479:-1 gene:ENSMLUG00000027708 transcript:ENSMLUT00000024999 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKLNNLLVFTVLLALRILSSWAVVDAGKEKAKPGACPFIYPANCLVHEPPQCHSDWQCPK
KQKCCPGLCGIKCLDPEDPSKPVQVNPGKCPVVTGQCKMLNPRDECRNDSHCLKSLKCCK
GMCGHSCVKPV
Download sequence
Identical sequences G1Q883
XP_014313602.1.53796 ENSMLUP00000019916 ENSMLUP00000019916

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]