SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000019952 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000019952
Domain Number 1 Region: 433-577
Classification Level Classification E-value
Superfamily CBS-domain pair 4.64e-16
Family CBS-domain pair 0.01
Further Details:      
 
Weak hits

Sequence:  ENSMLUP00000019952
Domain Number - Region: 670-719
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 0.00065
Family cAMP-binding domain 0.03
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000019952   Gene: ENSMLUG00000023959   Transcript: ENSMLUT00000023207
Sequence length 875
Comment pep:known_by_projection scaffold:Myoluc2.0:GL429929:1245133:1340411:1 gene:ENSMLUG00000023959 transcript:ENSMLUT00000023207 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MIGCGSCEPEVKMAGGQAAAALPTRKMAARRSLSARGRGVLQAAAERLLPLLLLSCCCSA
GGCAAAGENEETVIIGLRLEDTNDVSFMEGGALRVSERTRVKLRVYGQNINNETWSRIAF
TEHERRRHSPGERGLGGPAPPEPDSGPQRCGIRTSDIIILPHIILNRRTSGIIEIEIKPL
RKMEKSKSYYLCTSLSTPALGTGGPGSAGGTVGGKGGSGVAGLPPPPWAETTWIYHDGED
TKMIVGEEKKFLLPFWLQVIFISLLLCLSGMFSGLNLGLMALDPMELRIVQNCGTEKEKN
YAKRIEPVRRQGNYLLCSLLLGNVLVNTTLTILLDDIAGSGLVAVVVSTIGIVIFGEIVP
QAICSRHGLAVGANTIFLTKFFMMMTFPASYPVSKLLDCVLGQEIGTVYNREKLLEMLRV
TDPYNDLVKEELNIIQGALELRTKTVEDVMTPLRDCFMITGEAILDFNTMSEIMESGYTR
IPVFEGERSNIVDLLFVKDLAFVDPDDCTPLKTITKFYNHPLHFVFNDTKLDAMLEEFKK
GKSHLAIVQRVNNEGEGDPFYEVLGIVTLEDVIEEIIKSEILDETDLYTDNRTKKKVAHR
ERKQDFSAFKQTDSEMKVKISPQLLLAMHRFLATEVEAFSPSQMSEKILLRLLKHPNVIQ
ELKYDEKNKKAPEYYLYQRNKPVDYFVLILQGKVEVEAGKEGMKFEASAFSYYGVMALTA
SPVPLSLSRTFVVSRTELLAAGSPGENKSPPRPCGLNHSDSLSRSDRIDAITPSLGSSNN
QLNSSFLQVYIPDYSVRALSDLQFVKISRQQYQNALMASRMDKTPQSSDSENTKIELTLT
ELHDGLPDETANLLNEQNCVTHTKANHSLHNEGAI
Download sequence
Identical sequences G1Q8B9
ENSMLUP00000019952 XP_006095965.1.53796 ENSMLUP00000019952

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]