SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000019971 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000019971
Domain Number 1 Region: 11-150
Classification Level Classification E-value
Superfamily PH domain-like 2.1e-28
Family Pleckstrin-homology domain (PH domain) 0.00000394
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000019971   Gene: ENSMLUG00000001449   Transcript: ENSMLUT00000024410
Sequence length 635
Comment pep:known_by_projection scaffold:Myoluc2.0:GL431425:19364:42873:1 gene:ENSMLUG00000001449 transcript:ENSMLUT00000024410 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEEGRPRSSLSLASSASTISSLSSLSTKKIPTSAHGPRSFNRTVHARPHVDPLLILSSLS
PQDSSGLRLWKRRWFVLSGHCLFYYKDSREESVLGSVLLPSYSVRPDGPGAPRGRRFTFT
AEHPGMRTYVLAADTLEDLRGWIRALGRASRAEGDDGPLKTTSVRPAPSTDPRPGGGPPH
NFRRLTPRLVVKSLVFFFLEGQGRHHKGRHVFEADLLLLARDSSLFTPLSRPPSPLSLPR
PRSAPARRPPPSSSGDTPLPARPHTPLSRIDVRPPSEWGPQRQALSRPPTPRRGPASEAG
GGRPPRSPQPWHQEARTQYSSQVPSGSSTYIQLPPRSPGTRASMVLLRGPPPDSSFNQSL
GTDVIPPGTQPLLRSRVGRRYSRRSSFSLSAQEQLEAALELTRQQLGQAAREAAAPPRAW
GRQRLLQDRLVSVRATLCHLTQERERVWDTYSGLEQELGTLRETLEYLLHLGSPQDRTSA
QQQLWMMEDTLAGLGGPQKPPQSTEPDSPSPALQGEESSERESLPESLELSSPRSPEADW
GRPPGGDRGPASPRSGVGSPRISQASSREGRCPPSPQPGAKPPQARPRMSAQEQLERLRR
NQECGRPLPRPASPRLLTLGRTLSPARCQPDAEQK
Download sequence
Identical sequences G1Q8D8
ENSMLUP00000001331 ENSMLUP00000019971

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]