SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000019979 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000019979
Domain Number 1 Region: 15-140
Classification Level Classification E-value
Superfamily PDZ domain-like 4.56e-22
Family PDZ domain 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000019979   Gene: ENSMLUG00000027046   Transcript: ENSMLUT00000023357
Sequence length 169
Comment pep:novel scaffold:Myoluc2.0:GL430429:292946:326714:-1 gene:ENSMLUG00000027046 transcript:ENSMLUT00000023357 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VSKNKDGKEQSETVSPSEDEAFSWPGPKTVMLKRTSQGFGFTLRHFIVYPPESAIQFSYK
DEENGNRGGKQRNRLEPMDTIFVKQVKEGGPAFEAGLCTGDRIIKVNGESVIGKTYSQVI
ALIQNSDTTLELSVMPKDEDILQVVSFIYSNMNYILVMSVNKNLSKRKL
Download sequence
Identical sequences G1Q8E6
ENSMLUP00000019979 ENSMLUP00000019979

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]