SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000020002 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000020002
Domain Number 1 Region: 4-56
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 1.05e-18
Family Ribosomal protein L24e 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000020002   Gene: ENSMLUG00000022472   Transcript: ENSMLUT00000025940
Sequence length 157
Comment pep:known_by_projection scaffold:Myoluc2.0:GL429790:2994413:2994962:1 gene:ENSMLUG00000022472 transcript:ENSMLUT00000025940 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKVELCSFSGYKIYPGHGRRYARTNGKVFQFLNAKCGSAFLSKRNPRQINWTVLYRRKYK
KGQLEEIQKKRTRRAVKFQRAITGASLADIMAKRNQKPKVRKAQREQAIRAAKEAKKAKQ
ASKKTAMAAAKAPTKAAPKQKIVKPVKVSAPRVGRKR
Download sequence
Identical sequences G1Q8G9
ENSMLUP00000020002 ENSMLUP00000020002

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]