SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000020020 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000020020
Domain Number 1 Region: 116-176
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 0.000000000243
Family Translational machinery components 0.014
Further Details:      
 
Weak hits

Sequence:  ENSMLUP00000020020
Domain Number - Region: 30-90
Classification Level Classification E-value
Superfamily dsRNA-binding domain-like 0.00356
Family Ribosomal S5 protein, N-terminal domain 0.0088
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000020020   Gene: ENSMLUG00000022940   Transcript: ENSMLUT00000027458
Sequence length 210
Comment pep:known_by_projection scaffold:Myoluc2.0:GL430152:348007:348668:1 gene:ENSMLUG00000022940 transcript:ENSMLUT00000027458 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LDKDMKIKSLEEIYLFSLPIKGSEIIDFFLEATLKEEVLNMNTEAVQTQTRAGQRHLLPL
GDYNGHVSPDVKCPEEVAIVICEAILLAKLLTVPCSEATRGTRLASPTLACKVSTAVALG
APRDTGLVSAPVPKRLLLLAGIRDCYTSARGCTAIGNFTKATSKTYSYLTPKLWKETVTT
PPYQEFTDHLVKTHTAVSVQRPQVPAVTHH
Download sequence
Identical sequences G1Q8I7
ENSMLUP00000020020 ENSMLUP00000020020

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]