SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000020104 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000020104
Domain Number 1 Region: 12-146
Classification Level Classification E-value
Superfamily Cyclophilin-like 4.53e-51
Family Cyclophilin (peptidylprolyl isomerase) 0.00000025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000020104   Gene: ENSMLUG00000028561   Transcript: ENSMLUT00000027500
Sequence length 147
Comment pep:novel scaffold:Myoluc2.0:GL429809:4018251:4018694:1 gene:ENSMLUG00000028561 transcript:ENSMLUT00000027500 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PPTPTPDSWQPPNVYLETSMGTIVLELYWKHAPKTCKNFAELAHRGYYNSTKFHRIIKAS
MVQGGDPTGRGGASIYGKQFEDEFHPDLKFTGAGILAMANAGPDTNGGQFFVTLAPTQWL
DGEHTIFGPMCQGIGMVNRVGMVETNS
Download sequence
Identical sequences G1Q8S1
ENSMLUP00000020104 ENSMLUP00000020104

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]