SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000020119 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000020119
Domain Number 1 Region: 104-204
Classification Level Classification E-value
Superfamily PDZ domain-like 1.97e-18
Family PDZ domain 0.00011
Further Details:      
 
Domain Number 2 Region: 192-294
Classification Level Classification E-value
Superfamily PDZ domain-like 0.0000000000000223
Family PDZ domain 0.00014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000020119   Gene: ENSMLUG00000003905   Transcript: ENSMLUT00000014051
Sequence length 297
Comment pep:known_by_projection scaffold:Myoluc2.0:GL429827:881629:890526:1 gene:ENSMLUG00000003905 transcript:ENSMLUT00000014051 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSTLYPSLEDLKVDQAVQAQARDTPKMPILPVQETPVPQPPVLYPNLAELENYMGLSLSS
QEVQQNLPQSPDGTSVGTVVSGPSPGQVVAPVSGNSLGVRRAEIKPGVREIHLCKDERGK
TGLRLRAINKGLFVQLVQVNTPASLVGLRFGDQILQIDGRDCAGWSTDRAHRAVKRASAE
KIVMVVRDRPFQRTVTMHRDSTGHVGFVIKKGKVVSIVKGSSAARNGLLTNHYVCEVNGQ
NVIGLKGSGQRGVTEILATAGSVITLTIIPTVIYEHMVKKLSPTLLRHTMDHSIPDV
Download sequence
Identical sequences G1Q8T6
ENSMLUP00000020119 ENSMLUP00000003560

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]