SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000020123 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000020123
Domain Number 1 Region: 2-163
Classification Level Classification E-value
Superfamily Cyclophilin-like 4.09e-66
Family Cyclophilin (peptidylprolyl isomerase) 0.0000000763
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000020123   Gene: ENSMLUG00000028801   Transcript: ENSMLUT00000027356
Sequence length 164
Comment pep:novel scaffold:Myoluc2.0:GL429926:991445:991988:-1 gene:ENSMLUG00000028801 transcript:ENSMLUT00000027356 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGNPTVYLDIAADVEPQGRVSFELFADKVPKTAENFCALSTGEKGFGSKGSCFHRIILGF
MCQGGDFTRHNGTGGKSIHGEKFEDENFVLKHTGPGILSMVNAGPNTNGSQFFFCAAKPE
WLDGKHVVFQVKEGMDIVTAMERFGSRNGKTSEKLTIADCGQLY
Download sequence
Identical sequences G1Q8U0
ENSMLUP00000020123 ENSMLUP00000020123

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]