SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000020129 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000020129
Domain Number 1 Region: 542-754
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 1.96e-52
Family BCR-homology GTPase activation domain (BH-domain) 0.0000688
Further Details:      
 
Domain Number 2 Region: 107-363
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 1.94e-29
Family FCH domain 0.047
Further Details:      
 
Domain Number 3 Region: 483-537
Classification Level Classification E-value
Superfamily Cysteine-rich domain 0.0000000366
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000020129   Gene: ENSMLUG00000023678   Transcript: ENSMLUT00000030893
Sequence length 968
Comment pep:known_by_projection scaffold:Myoluc2.0:GL430078:1130244:1139461:-1 gene:ENSMLUG00000023678 transcript:ENSMLUT00000030893 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDAAEPGLPPAPESRKRYSDIFRSLDNLEISLGNATLEMLAGDPILSGDPEPDKTPMATV
TSETSHWSGPSQRVLHPYRGEELDLRLIRTKGGVDAALEYAKTWSRYKELLAWTEKRASL
ELDFTKSIMKIAEAGKVSIQQQSHMPLQYIYTLFLEHDLSLGALAMETVAQQKRDYYQPL
ASKRTEIEKWRKEFKEQWMKEQKRMNEAVQALRRAQLHYLHRSEDLQVRAQASSEDPAPQ
ASPGHSKQQERRRRSREEAQAKVQEAEALYQACVREANARQQDLEATKQRIVSHIRKLVL
QGDEVMKRVTLGLFWLRGAQAERGPRAFTALAECCAPFEPGQRFQEFVRTLQPEAPPPPP
PAFSFQEFVPTPHSSPLDTKKKLSGPPPPRLDESAAEPGPGEDTGPVWQGTPGPTPGSDV
DSVGGSSESRSLDSPTSSPGPGTRRLVKVSSTGTESSDDFEERDPDLGDGLENGSGSPFR
KWTLSNAAQTHRLRRLRGPAKCRECEAFMVSGTECEECFLTCHKRCLETLLILCGHRRLP
ARTPLFGVNFLQLPRDFPEEVPFVVTKCTAEIEQRALGVQGIYRVSGSRVRVERLCQAFE
NGRALVDLSGNSPHDVSTVLKRFLQELTDPVVPSHFYDAFISLAKTLHANPGHDSETPSP
SPEVIRLLKTLLMQLPDSNYNTLRHLVAHLFRVAAQFEENKMSANNLGIVFGPTLLRPPD
DPGAAATGSVTCLLDFGHQAQLVEFLIVHYEQIFGMDELPLATELPPQDASPAPGPLTTS
PQPAPPYLAPDPLPPTLPSDSDPGPEPHSAPEKHPEVMPSEIPTPQSDQREEVAQDTKEE
RGEVSSQGPEDSLLGTQSRGYFSRQPVKYHRGGVRPVTHQLSSLALVAYKIDEETPVTSE
PQGSLRGRGPGPAAASPEGTPPRRTPLPKHFEITQETARLLSKLHREEVPTATCCPDPPP
EDEEVERL
Download sequence
Identical sequences G1Q8U6
ENSMLUP00000020129 ENSMLUP00000020129

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]