SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000020150 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000020150
Domain Number 1 Region: 58-205
Classification Level Classification E-value
Superfamily Ferritin-like 2.03e-53
Family Ferritin 0.000000864
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000020150   Gene: ENSMLUG00000027694   Transcript: ENSMLUT00000022922
Sequence length 206
Comment pep:novel scaffold:Myoluc2.0:GL430343:397552:398347:1 gene:ENSMLUG00000027694 transcript:ENSMLUT00000022922 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SGHIPALSGTNRSWCCVPEPPSLMIILPPSDPSQPSSVPETSQHRFLSLTYCQAAMSSQI
RQNYSTRVEAAFNCLVNLHLQAFYTYLSLSFYFSHQDMALEGVGHFFRELAEEKHKGADC
LLKMQNQRGGKAFFQKVKKPSQDEWGKTQDAMEAAMALEKNLNQALLDLHTLGSTSTDLH
LCDFLKNHFLDEVKIIRKIGDHLTSI
Download sequence
Identical sequences G1Q8W7
ENSMLUP00000020150 ENSMLUP00000020150

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]