SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000020170 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000020170
Domain Number 1 Region: 1-41
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.0000000000000645
Family Ubiquitin-related 0.00039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000020170   Gene: ENSMLUG00000025701   Transcript: ENSMLUT00000024948
Sequence length 41
Comment pep:known_by_projection scaffold:Myoluc2.0:GL430173:586801:587091:1 gene:ENSMLUG00000025701 transcript:ENSMLUT00000024948 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
TGKEIEIDIEPTDKVERIKERVEEKEGIPPQQQRLIYSGKQ
Download sequence
Identical sequences A1XEA8 G1Q8Y7
ENSMLUP00000020170 ENSMLUP00000020170

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]