SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000020202 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000020202
Domain Number 1 Region: 525-613
Classification Level Classification E-value
Superfamily PH domain-like 2.09e-18
Family Third domain of FERM 0.0053
Further Details:      
 
Domain Number 2 Region: 332-425
Classification Level Classification E-value
Superfamily PH domain-like 2.12e-17
Family Pleckstrin-homology domain (PH domain) 0.0058
Further Details:      
 
Domain Number 3 Region: 222-273
Classification Level Classification E-value
Superfamily Second domain of FERM 0.0000000072
Family Second domain of FERM 0.011
Further Details:      
 
Domain Number 4 Region: 472-524
Classification Level Classification E-value
Superfamily Second domain of FERM 0.000068
Family Second domain of FERM 0.0041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000020202   Gene: ENSMLUG00000002453   Transcript: ENSMLUT00000030845
Sequence length 636
Comment pep:known_by_projection scaffold:Myoluc2.0:GL429958:1840392:1878519:1 gene:ENSMLUG00000002453 transcript:ENSMLUT00000030845 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
IDVKKDWSDHALWWEKKRTWLLKTHWTLDKYGIQADAKLQFTPQHKLLRLQLPNMKYVKV
KVNFSDRVFKAVSDICKTFNIRHPEELSLLKKPRDPTKKKKKKLDDQSEDEALELEGPLI
TPGSGSIYSSPGLYSKTMTPTYDAHDGSPLSPTSAWFGDSALSEGNPGILAVSQPITSPE
ILAKMFKPQALLDKAKINQGWLDSSRSLMEQDVKENEALLLRFKYYSFFDLNPKYDAIRI
NQLYEQAKWAILLEEIECTEEEMMMFAALQYHINKLSIMTSENHLNNSDKEVDEVDAALS
DLEITLEGGKTSTILGDITSIPELADYIKVFKPKKLTLKGYKQYWCTFKDTSISCYKSKE
EASGTPAHQMNLRGCEVTPDVNISGQKFNIKLLIPVAEGMNEIWLRCDNEKQYAHWMAAC
RLASKGKTMADSSYNLEVQNILSFLKMQHLNPDPQLIPEQITTDINPECLVSPRYLKKYK
NKQPGYIRDLITARILEAHQNVAQMSLIEAKMRFIQAWQSLPEFGITHFMARFQGGKKED
LIGITYNRLIRMDASTGDAIKTWRFSNMKQWNVNWEIKMVTVEFADEVRLSFICTEVDCK
VVHEFIGGYIFLSTRAKDQNESLDEEMFYKLTSGWV
Download sequence
Identical sequences G1Q919
ENSMLUP00000020202 ENSMLUP00000020202

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]