SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000020205 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000020205
Domain Number 1 Region: 7-121
Classification Level Classification E-value
Superfamily PH domain-like 4.46e-28
Family Pleckstrin-homology domain (PH domain) 0.0041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000020205   Gene: ENSMLUG00000003375   Transcript: ENSMLUT00000003373
Sequence length 215
Comment pep:known_by_projection scaffold:Myoluc2.0:GL430023:792952:793599:-1 gene:ENSMLUG00000003375 transcript:ENSMLUT00000003373 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LAFYATCDAPVDNAGFLYKKGGRHAAYHRRWFVLRGNMLFYFEDVASREPVGVIILEGCT
VELVEAAEEFTFAVRFAEARARTYVLAAESQAAMEGWVKALSRASFDYLRLVVRELEQQL
AAMRAGGCPPPPRRPRALLPKENGCAVWSAEPPAASTGTSTGARSGPERPPLPPRRRASA
PNGPLDSASFLQLHEWYGQEVRALRSQWLRSRAQP
Download sequence
Identical sequences G1Q922
ENSMLUP00000020205 ENSMLUP00000020205

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]