SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000020249 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000020249
Domain Number 1 Region: 31-74
Classification Level Classification E-value
Superfamily Elafin-like 0.0000000000615
Family Elafin-like 0.0012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000020249   Gene: ENSMLUG00000023696   Transcript: ENSMLUT00000022895
Sequence length 77
Comment pep:novel scaffold:Myoluc2.0:GL430419:438115:439169:-1 gene:ENSMLUG00000023696 transcript:ENSMLUT00000022895 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKTGTVFVLVAIVILGMEMAFAQKRPPGGGEKPGFCPRLPKDAIGLCVEKCLGDDSCPGE
MKCCGNGCGHVCKRAIH
Download sequence
Identical sequences G1Q966
ENSMLUP00000020249 ENSMLUP00000020249

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]