SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000020348 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000020348
Domain Number 1 Region: 437-538
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 4.75e-24
Family SPRY domain 0.0008
Further Details:      
 
Domain Number 2 Region: 7-80
Classification Level Classification E-value
Superfamily RING/U-box 1.53e-20
Family RING finger domain, C3HC4 0.0081
Further Details:      
 
Domain Number 3 Region: 306-379
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.02e-18
Family SPRY domain 0.0028
Further Details:      
 
Domain Number 4 Region: 96-157
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 4.12e-16
Family B-box zinc-binding domain 0.0013
Further Details:      
 
Weak hits

Sequence:  ENSMLUP00000020348
Domain Number - Region: 384-425
Classification Level Classification E-value
Superfamily ARM repeat 0.00414
Family GUN4-associated domain 0.076
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000020348   Gene: ENSMLUG00000028946   Transcript: ENSMLUT00000030643
Sequence length 540
Comment pep:known_by_projection scaffold:Myoluc2.0:GL430288:544793:552812:1 gene:ENSMLUG00000028946 transcript:ENSMLUT00000030643 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MATAAPLRSLEEEVTCSICLDYLRDPVTIDCGHVFCRSCTADICPASGARPVCPLCKKPF
KKENIRPVWQLASLVENIERLKVDKGRQLGDAAREQQDARLCERHQEKLHYYCEDDGQLL
CVLCRESREHKPHTAVLLEKAAQPHREKILNHLSILRRDRDKIQGCQAKGEADILAALQK
LREQRQHVVAEFAQGHQFLREREQHLLDQLARLEQELAEGREKCQARGSGELARLALVIS
ELEGKAQQPAAELMQTAMEALDTRDFLNSFARETIVRVVKKRTESSSDKLVSLQRGLREF
PGKLLRDLEYKTVSVTLDPQSASRSLLLSEDCKCVTYNSDLYHCAYLHPQQFDCEPGVLG
SKGFTWGKVYWEVEVEREGWSEDEEDGDEEEEGEEEEEEEAGYGDGYDNWETDEDEESLG
DEEEEEEEEEEEEVLESCMVGVARDSVKRKGDLSLRPEDGVWALRLSSAGIWANTDPEAE
LFPAARPRRVGIALDYEGGAVTFTNAESQELLHTFTATFTRRLVPFLWLKWPGTRLLLRP
Download sequence
Identical sequences G1Q9G5
ENSMLUP00000020348 ENSMLUP00000020348

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]