SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000020365 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000020365
Domain Number 1 Region: 3-92
Classification Level Classification E-value
Superfamily EF-hand 5.32e-21
Family S100 proteins 0.0000124
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000020365   Gene: ENSMLUG00000029390   Transcript: ENSMLUT00000025009
Sequence length 101
Comment pep:known_by_projection scaffold:Myoluc2.0:GL429918:1004494:1005241:1 gene:ENSMLUG00000029390 transcript:ENSMLUT00000025009 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MARPLEQAVAAIVCTFQEYAGRCGDKHKLCQAELKELLQKELPTWMPTELRECDYNKFMS
LLDTNKDCEVDFVEYVRSLACLCTYCHDYFKDCPPEPPCSQ
Download sequence
Identical sequences G1Q9I2
ENSMLUP00000020365 XP_005867484.1.60319 XP_005867485.1.60319 XP_014316696.1.53796 XP_014316699.1.53796 XP_014316700.1.53796 XP_014316701.1.53796 XP_014396216.1.60319 XP_014396217.1.60319 ENSMLUP00000020365

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]