SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000020447 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000020447
Domain Number 1 Region: 1-100
Classification Level Classification E-value
Superfamily Histone H3 K4-specific methyltransferase SET7/9 N-terminal domain 4.71e-20
Family Histone H3 K4-specific methyltransferase SET7/9 N-terminal domain 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000020447   Gene: ENSMLUG00000004589   Transcript: ENSMLUT00000030166
Sequence length 246
Comment pep:known_by_projection scaffold:Myoluc2.0:GL429772:760582:768786:-1 gene:ENSMLUG00000004589 transcript:ENSMLUT00000030166 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VYRGHFGLDMKLGYGEFSWPTGESYHGQFYRDHRHGFGTYMWPDGSSFTGMFYLSFREGY
GTMYMKTRLFQGLYKADERFGPGIETYPDGSQEVGLWFREHLIKLCTEIPCSVSISSYPE
FQGFLTHSPARISLSEEETMHWDLQEERDPFFYNYKQFLLNDDLTLPPDVYLYSTDNTHM
PITRSFRRDLDSRIFLHDIPPFVEDGEPWFIKNETPLMVKIQKHTYKFRFTVTLTLSICC
WTTVLM
Download sequence
Identical sequences G1Q9R4
ENSMLUP00000020447

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]