SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000020528 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000020528
Domain Number 1 Region: 92-313
Classification Level Classification E-value
Superfamily Clavaminate synthase-like 1.56e-31
Family TehB-like 0.095
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000020528   Gene: ENSMLUG00000026459   Transcript: ENSMLUT00000028880
Sequence length 531
Comment pep:novel scaffold:Myoluc2.0:GL429873:362995:364587:1 gene:ENSMLUG00000026459 transcript:ENSMLUT00000028880 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LRTQESSAYTAAMVSNEPSGRIMTFHPTIEEFKDFNKYIGYMESQGAHRAGLAKVIPPKE
WKARQTYDDVSDMVIATPLQQVASGRAGVFIQYHKKKRAMTVGEYRLWANSGQYQTPPHL
DFEDLERKYWKTRLYDSPIYGADVSGSLFDANTKQWNLGHLGTIQDLLEQECGVVIEGVN
TPYLYFGMWKTTFAWHTEDMDLYSINYLHFGEPKRGTRAPEHGLHLERLARELFPGSSRG
CQAFLRHKVALISPTVLKENGVPFSRITQEAGEFMVTFPYGYHAGFNHGFNCAEAINFAT
PRWVDYGKVASQCSCGEARVSFSMDVFVRLLQPERYELWKCGQDRTVVDHVEPRAPGSQE
LSAWREGRAAWRSAPGLRHHQPRRATHTPRSVGTGCGYGRRHTLVHQPCLHPSLGRGSAS
AAQPAAAAALCSSKPNPSSQPTSGPAAQDLQPTGTRGRESGRRPQEQWTQEWIVQAPAKR
RRLVGAVRTAPDPQAQPVPEDKPSMDDSPAPLSPGGQHPVWASGCCCAPDL
Download sequence
Identical sequences G1Q9Z5
ENSMLUP00000020528 ENSMLUP00000020528

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]