SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000020533 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000020533
Domain Number 1 Region: 68-368
Classification Level Classification E-value
Superfamily BEACH domain 6.02e-128
Family BEACH domain 0.0000000000139
Further Details:      
 
Domain Number 2 Region: 486-739
Classification Level Classification E-value
Superfamily WD40 repeat-like 8.99e-32
Family WD40-repeat 0.0063
Further Details:      
 
Domain Number 3 Region: 2-63
Classification Level Classification E-value
Superfamily PH domain-like 3.38e-18
Family PreBEACH PH-like domain 0.0000495
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000020533   Gene: ENSMLUG00000022464   Transcript: ENSMLUT00000022528
Sequence length 752
Comment pep:known_by_projection scaffold:Myoluc2.0:GL429774:19313495:19484039:1 gene:ENSMLUG00000022464 transcript:ENSMLUT00000022528 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VLAYTEGLHGKWMFSEIRAVFSRRYLLQNTALEVFMANRTSVMFNFPDQATVKKVVYSLP
RVGVGTSYGLPQARRISLATPRQLYKSSNMTQRWQRREISNFEYLMFLNTIAGRTYNDLN
QYPVFPWVLTNYESEELDLTLPGNFRDLSKPIGALNPKRAVFYAERYETWEDDQSPPYHY
NTHYSTATSTLSWLVRIEPFTTFFLNANDGKFDHPNRTFSSVARSWRTSQRDTSDVKELI
PEFYYLPEMFVNSNGYSLGVREDEVVINNVDLPPWAKKPEDFVRINRMALESEFVSCQLH
QWIDLIFGYKQRGPEAVRALNVFHYLTYEGSMNLDSITDPVLREAMEAQIQNFGQTPSQL
LIEPHPPRSSAMHLCFLPQSPLMFKDQMQQDVIMVLKFPSNSPVTHVAANTLPHLTIPAV
VTVTCSRLFAVNRWHNTSVGLRGAPGYSLDQAHHLPIEMDPLIANNSGVNKRQITDLVDQ
SIQINAHCFVVTADNRYILICGFWDKSFRVYSTETGKLTQIVFGHWDVVTCLARSESYIG
GDCYIVSGSRDATLLLWYWSGRHHIIGDNPNSSDYPAPRAVLTGHDHEVVCVSVCAELGL
VISGAKEGPCLVHTITGDLLRALEGPENCLFPRLISVSSEGHCIIYYERGRFSNFSINGK
LLAQMEINDSTRAILLSSDGQNLVTGGDNGVVEVWQACDFKQLYIYPGCDAGIRAMDLSH
DQRTLITGMASGSIVAFNIDFNRWHYEHQNRY
Download sequence
Identical sequences G1QA00
ENSMLUP00000020533

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]