SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000020572 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000020572
Domain Number 1 Region: 309-624
Classification Level Classification E-value
Superfamily L domain-like 3.4e-44
Family Leucine rich effector protein YopM 0.0041
Further Details:      
 
Domain Number 2 Region: 652-902
Classification Level Classification E-value
Superfamily PP2C-like 3.66e-44
Family PP2C-like 0.0014
Further Details:      
 
Domain Number 3 Region: 121-363
Classification Level Classification E-value
Superfamily RNI-like 1.41e-36
Family 28-residue LRR 0.096
Further Details:      
 
Domain Number 4 Region: 20-119
Classification Level Classification E-value
Superfamily PH domain-like 0.000000323
Family Pleckstrin-homology domain (PH domain) 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000020572   Gene: ENSMLUG00000000103   Transcript: ENSMLUT00000002043
Sequence length 1191
Comment pep:known_by_projection scaffold:Myoluc2.0:GL429803:5653252:5764605:1 gene:ENSMLUG00000000103 transcript:ENSMLUT00000002043 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LNCLFALVPGKPHSTCSSERIQLSGMYNVRKGKMQLPVNRWTRRQVILCGTCLIVSSVKD
SLTGKMHVLPLIGGKVEEVKKHQHCLAFSSSGPQSQTYYICFDTFTEYLRWLRQVSKVAS
QRISSVDLSCCSLEHLPANLFYSQDLTHLNLKQNFLRKQEPGGLKTVIRFTKLKSLNLSN
NHLGDFPLAVCNIPTLTELNVSCNALRAVPAAVGVMHNLQTFLLDGNFLQSLPAELENMH
QLSYLGLSFNEFTDIPEVLEKLTAVDKLCMSGNCMETLRLQALRKMPHIKHVDLRLNIIK
KLIADEVDFLQHVTQLDLRDNKLGDLDAMIFNNIEVLHCERNQLVTLNICGYFLKALYAS
SNELVQLDVYPVPNYLFYMDVSRNCLENVPEWVCESRKLEVLDIGHNQICELPARLFCNS
SLRKLLAGHNQLTSLPERLERTSVEVLDVQHNQLLELPPNLLMKADSLRFLNASANKLET
LPAATLSEETSSILQELYLTNNNLTDKCVPLLTGHPHLKILHMAYNRLQSFPASKMAKLE
ELEEVDISGNKLKAIPTTITNCRRMHTVIAHSNCIEVFPEVMQLPEIKCVDLSCNELSEV
TLPENLPPKLQELDLTGNPRLALDHKTLELLNNIRCFKIDQPSAGDASGAPAVWSHGYTE
ASGVKNKLCVAALSVNNFCDNREALYGVFDGDRNVEVPYLLQCTMSDILAEELQKTKNEE
EYMVNTFVVMQRKLGTAGQKLGGAAVLCHIKHDPVDPGGSFTLTSANVGKCQTVLCRNGK
PLPLSRSYVMSCEEELRRIKQHKAIITEDGKVNGVTESTRILGYTFLHPSVVPRPHVQSV
ALTPQDEFFILGSKGLWDSLSIEEAVGAVRNVPDALSAAKKLCTLAQSYGCRDSLSAVVV
QLSVTEDSFCCCDLGAGGAGPPPSPGIFPPSVSMVIKDRPSDGLGVPSSSSGMASEISSE
LSTSEMSSEVGSTASDEPPPGALSESGPPYPSEQRCLLHPACLSSAFQRQLSSATFSSAF
SDNGLDSDDEEPIEGVFSNGSRVEVEVDIHCGRAKDRDKQQHLLQVPAEASDEGIVISAN
EDEPGLPRKADFASMGTIGRRRANGSVAPQERSHNVIEVATEAPLRKPGGYFAAPAQPDP
EDQFIIPPELEEEVKEIMKHHQQQQPPAQLPLQPPRQCPADPLPDYCDTPL
Download sequence
Identical sequences G1QA39
ENSMLUP00000020572 ENSMLUP00000020572

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]