SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000020588 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000020588
Domain Number 1 Region: 109-222
Classification Level Classification E-value
Superfamily PDZ domain-like 4.6e-27
Family PDZ domain 0.0038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000020588   Gene: ENSMLUG00000028142   Transcript: ENSMLUT00000023524
Sequence length 335
Comment pep:known_by_projection scaffold:Myoluc2.0:GL429963:1107988:1111702:1 gene:ENSMLUG00000028142 transcript:ENSMLUT00000023524 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEAHTRGATDLRGSRGGTLGLGWQGPSGPGARQFLARLDARPLAARAAADVAALVRRAGA
TLGLRPKDELAISDLDSADIEVTDSRLPNPTFVEHRPQHRRSETLGTSTGPPQVNQIKPR
HASKSPQASGPFFVELVRGSAGFGLTLSGGRDAARDTPLAVRGLLKDGPAQRCGRLQAGD
LVLQVNGESTQGLTHAQVVERIRSGGPRLHLVLSRPLETHPSKPERGGGPRKGDDRSPDP
GGPEATRSPSASASPLDHPQSRTTPKTRPSLEPSPEGAGDGLVVPLERRTQDPDDRSPGS
PGPWLVPSEERLSRALGVPAATQLALEMAAGRRRH
Download sequence
Identical sequences G1QA55
ENSMLUP00000020588

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]