SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000020593 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000020593
Domain Number 1 Region: 2-187
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 6.8e-45
Family IMD domain 0.00012
Further Details:      
 
Domain Number 2 Region: 300-345
Classification Level Classification E-value
Superfamily SH3-domain 0.00000221
Family SH3-domain 0.003
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000020593   Gene: ENSMLUG00000026542   Transcript: ENSMLUT00000023867
Sequence length 467
Comment pep:known_by_projection scaffold:Myoluc2.0:GL430180:540738:559038:-1 gene:ENSMLUG00000026542 transcript:ENSMLUT00000023867 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
ALSEAAEVYFSAIQKIGEQALQSSTSQILGEILVQMSDTQRHLNSDLEVVVLRVQTFHGD
LLQHMEKNTKLDMQFIKDSRQHYEIEYRHRAANLEKCMSELWRMERKRDKNVREMKESVN
RLHAQMQTFVSESQRAAELEEKRRYRFLAEKHLLLSNTFLQFFGRARGTLQNRVLLWKEQ
SEASRNPSRAHSPGLLGPVLGPPYPSGPPDAPPALGHGRAPRRFFAPPPRAPPPVIGAGQ
LRPPATFPRAPSWGALAGDTRLACVLECRERPPQGDEMCSPQSSGASRTRRARGSCAPWE
GGWITGTLCFPSRSGWFPEAYVKPLEEVPVNPMNPMNPLNPVTSMNPMSPMNELPSRLRS
YPLRGSHSLDDLLDRPGNATAPSEYWDGQPRSRTPSRVPSRAPSPAPTPLPGSRRGSMGS
TGVASDIKKLMSWEQQPPELFPRGTNPFATVKLRPTVTNDRSAPLIR
Download sequence
Identical sequences G1QA60
ENSMLUP00000020593 ENSMLUP00000020593

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]