SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000020616 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000020616
Domain Number 1 Region: 63-255
Classification Level Classification E-value
Superfamily NAD kinase/diacylglycerol kinase-like 2.03e-30
Family Diacylglycerol kinase-like 0.01
Further Details:      
 
Weak hits

Sequence:  ENSMLUP00000020616
Domain Number - Region: 1-27
Classification Level Classification E-value
Superfamily Cysteine-rich domain 0.00207
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000020616   Gene: ENSMLUG00000022545   Transcript: ENSMLUT00000025974
Sequence length 267
Comment pep:novel scaffold:Myoluc2.0:AAPE02066305:1123:9128:1 gene:ENSMLUG00000022545 transcript:ENSMLUT00000025974 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RCIWCQKTVHDECMRSSLKNETCDFGEFRNLIIPPSYLTSINQMRKDKKTDYAMLASKLG
KQWTPLIILANSRSGTNMGDGLLGEFRILLNPVQVFDVTKTPPIKALQLCTLLPYHSARV
LVCGGDGTVGWVLDAIDEMKIKGQEKYIPQVAVLPLGTGNDLSNTLGWGTSYTGEIPVAQ
VLRNVMEADGIKLDRWKVQVTNKGYYNLRKPKEFTMNNYFSVGPDALMALNFHAHREKAP
SLFSSRILNKAGYILGYSFGGSLVLEF
Download sequence
Identical sequences G1QA83
ENSMLUP00000020616 ENSMLUP00000020616

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]