SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000020701 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000020701
Domain Number 1 Region: 22-72
Classification Level Classification E-value
Superfamily Elafin-like 0.00000000000902
Family Elafin-like 0.0013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000020701   Gene: ENSMLUG00000025097   Transcript: ENSMLUT00000030266
Sequence length 74
Comment pep:novel scaffold:Myoluc2.0:GL430154:175094:176132:-1 gene:ENSMLUG00000025097 transcript:ENSMLUT00000030266 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKTGTAFVLVAFVILGMEMAFTQARPDYKPGLCPKVPEGTVGPCVQRCGGDDTCPSDLKC
CSNGCGYECTPPIF
Download sequence
Identical sequences G1QAG8
ENSMLUP00000020701 ENSMLUP00000020701

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]