SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000020772 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000020772
Domain Number 1 Region: 249-486
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 1.97e-63
Family Nuclear receptor ligand-binding domain 0.000000535
Further Details:      
 
Domain Number 2 Region: 7-91
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 9.68e-30
Family Nuclear receptor 0.00012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000020772   Gene: ENSMLUG00000029229   Transcript: ENSMLUT00000026560
Sequence length 497
Comment pep:known_by_projection scaffold:Myoluc2.0:GL429918:2401045:2410229:-1 gene:ENSMLUG00000029229 transcript:ENSMLUT00000026560 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
FPAQIEVIPCKICGDKSSGIHYGVITCEGCKGFFRRSQHCGVAYACTRQQNCPIDRTSRN
RCQHCRLQKCLALGMSRDAVKFGRMSKKQRDSLHAEVQKQLQQQQQQQQQQVARTPPAGG
QGAAALSCTLGLPDGQLPLGSSPDLPEASACPPGLLRAPGSRPTYSHSLAKAGLNGASYH
LEYSPERGKAEGRESFYSPGGPLTPDRYGLHVEDPRHPGRGDPGQGLDSYRSPSFRSTPE
APYASLTEIEHLVQNVCKSYRETCQLRLEDLLRQRSNLFSREEVAGYQRKSMWEMWERCA
HRLTEAIQYVVEFAKRLSGFMELCQNDQIVLLKAGAMEVVLVRMCRAYNASNHTVFFEGK
YGGVELFRALGCSELISSIFDFSRSLSALRLSEDEIALYTALVLINACRPGLQEKRKVEQ
LQSNLELAFHHHLCKTHRQGILAELPPKGKLRSLCSQHVEKLQTFQHLHPIVVQAAFPPL
YKELFSTEIEAPEGLSE
Download sequence
Identical sequences G1QAN9
ENSMLUP00000020772 ENSMLUP00000020772

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]