SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000020786 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000020786
Domain Number 1 Region: 75-198
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 3.68e-24
Family Regulator of G-protein signaling, RGS 0.0000758
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000020786   Gene: ENSMLUG00000027630   Transcript: ENSMLUT00000022630
Sequence length 206
Comment pep:known_by_projection scaffold:Myoluc2.0:GL429892:518408:554094:-1 gene:ENSMLUG00000027630 transcript:ENSMLUT00000022630 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRKRQQSQNEGTPAVSQAPGNQRPNNTCCFCWCCCCSCSCLTVRNEERAETAERPTLTTK
MESIQVLEEGQKPGSWLHNLDLNLSFPQCFPLFQIFLRTRTSESFINLYLLRIEKTNPTK
YRTLIKRKSSKIYEIYLHALWPKDIYLDSRVREVINRNLLDPNPHMYEDAQLQIYTLMHR
DSFPRFLNSQIYKSFVESTASSTSES
Download sequence
Identical sequences G1QAQ3
ENSMLUP00000020786 ENSMLUP00000020786

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]