SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000020915 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000020915
Domain Number 1 Region: 20-121
Classification Level Classification E-value
Superfamily Immunoglobulin 7.34e-41
Family V set domains (antibody variable domain-like) 0.0000251
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000020915   Gene: ENSMLUG00000028883   Transcript: ENSMLUT00000023306
Sequence length 136
Comment pep:novel scaffold:Myoluc2.0:GL430975:1744:2574:1 gene:ENSMLUG00000028883 transcript:ENSMLUT00000023306 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTLMWLFLFLLSAPRCVLSEVQLQESGPGLVTPSQTLSLTCTVTGYSITSGYCWSWIRQP
PGKGLEWMGCINNVGNLYYTPSLKSRTSISRDTSKNQFSLQLSSVTTEDTAVYYCTRDTV
RGRDHWGCRWAVTRET
Download sequence
Identical sequences G1QB32
ENSMLUP00000020915 ENSMLUP00000020915

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]