SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000020996 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000020996
Domain Number 1 Region: 155-259
Classification Level Classification E-value
Superfamily SH2 domain 2.69e-24
Family SH2 domain 0.00000891
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000020996   Gene: ENSMLUG00000028381   Transcript: ENSMLUT00000027342
Sequence length 270
Comment pep:novel scaffold:Myoluc2.0:GL429788:4357860:4359014:1 gene:ENSMLUG00000028381 transcript:ENSMLUT00000027342 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
EDKSCEYDQLYEEYTRTSQELQMKRTTMEAFNETIKIFQEQGQTQEKFSKEYLERFRCEG
NEKEMQRILLNSEWLKSCISEIQSHTKLEKELQIQADNLGKRMNSLKPDLMQLRKIQDQY
LVWTQKGAQQKKINEWLGIKNETEDQYALMEDENDLPHHEERTWYVGKINPTQAEEMLNS
KRDGTFLIGESNRRGCYACSVVVGSDTKHCVIYRLATGLGFAEPYNLYGSLKELVLHDQH
TSLMQHSNALTITLAHPIKAPGVLSPSLVP
Download sequence
Identical sequences G1QBB3
ENSMLUP00000020996 ENSMLUP00000020996

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]