SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000021075 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000021075
Domain Number 1 Region: 3-89
Classification Level Classification E-value
Superfamily RING/U-box 2.65e-18
Family RING finger domain, C3HC4 0.02
Further Details:      
 
Domain Number 2 Region: 91-152
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 0.000000000000107
Family B-box zinc-binding domain 0.0013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000021075   Gene: ENSMLUG00000026537   Transcript: ENSMLUT00000029823
Sequence length 402
Comment pep:known_by_projection scaffold:Myoluc2.0:GL430190:632901:634109:1 gene:ENSMLUG00000026537 transcript:ENSMLUT00000029823 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MHNFEDELTCPICYSIFEDPRVLPCSHTFCRNCLENVLQASGNFYIWRPLRIPLKCPNCR
SIIEIASTGIESLPVNFALRAIIEKYQQEDHPDIVTCPEHYRQPLNVYCLLDKKLVCGHC
LTIGQHHGHPIDDLQSAYLKEKDTPQKLLEQLTDTHWTDLTCLIEKLEEEKSHSEKVVQG
DKEVVLQYFKELSDILEQKKKKFLTALSDVGNLINQEYTPQIERIRDMRKQQLELMTLTT
SLQEESPLKFLEKVDDVRQRVQVLKQSPLPEVQRIEIYPRVSQVLKEDWSITEIGQIKKL
LIPEMKISSTRMPCSWPADEKEVEFFKILNIVIVTIISVILMLILFFNQHIITFLNENTS
LCFSEVSISVYQSLSNNLHNLKDMLYHTLYLLKEFMWKIVFR
Download sequence
Identical sequences G1QBJ2
XP_006102735.1.53796 XP_014323506.1.53796 ENSMLUP00000021075 ENSMLUP00000021075

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]