SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000021154 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000021154
Domain Number 1 Region: 6-146
Classification Level Classification E-value
Superfamily Ferritin-like 6.68e-19
Family Ferritin 0.00011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000021154   Gene: ENSMLUG00000024640   Transcript: ENSMLUT00000023005
Sequence length 187
Comment pep:novel scaffold:Myoluc2.0:GL429793:618757:619317:1 gene:ENSMLUG00000024640 transcript:ENSMLUT00000023005 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
APKFIHYSTQVEAAVTLLANLPLPAPHLPLSGLLFPPRQCGSGGRGGGRFFLELAEKNEG
AECLLKLQNQRGGRIPFQDVLKQNSGQVGKTQDTMEAALALERNPDPGPLGATGPGSTRT
DPPPGDFLQNHFRGEEVKLINKMGDIRLTSAGCWPRAGLGESFSKGSPSSTTRSLWSPEA
FEGPLCI
Download sequence
Identical sequences G1QBS1
ENSMLUP00000021154 ENSMLUP00000021154

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]