SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000021185 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000021185
Domain Number 1 Region: 1-78
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 3.54e-17
Family Translational machinery components 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000021185   Gene: ENSMLUG00000027424   Transcript: ENSMLUT00000026137
Sequence length 129
Comment pep:novel scaffold:Myoluc2.0:GL430006:943292:945132:1 gene:ENSMLUG00000027424 transcript:ENSMLUT00000026137 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PCKVTGRCGSVLERLIRAPRGTGVVSAPVPKKLPMMASIDLCYTSARGCTDTLGNFARAT
FDAISKTYSSLTPDLWTETVFTKNSLTLLSRPTPEFLCRGPGSSCGHHIILYKKNKISLP
LTKCLKRSV
Download sequence
Identical sequences G1QBV2
ENSMLUP00000021185 ENSMLUP00000021185

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]