SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000021209 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000021209
Domain Number 1 Region: 2-168
Classification Level Classification E-value
Superfamily Ferritin-like 5.41e-45
Family Ferritin 0.00000118
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000021209   Gene: ENSMLUG00000023187   Transcript: ENSMLUT00000023380
Sequence length 170
Comment pep:novel scaffold:Myoluc2.0:GL429971:1314257:1314986:-1 gene:ENSMLUG00000023187 transcript:ENSMLUT00000023380 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
AHQNYSTEVEAVVNHLALANLHLRASHTYLSLGFYFDLEVALEGVGHFFSELVEKKPEGT
EHLLKLQNQHGGRILSQDVLKPPQEWGKTQDSMEAALALERNLNQALLELQTLSSTRTDF
HLCDCLENHFLGEQVKLIKKMGDHLTHLQAAHHQAGLGEYLLKRLTLKHD
Download sequence
Identical sequences G1QBX6
ENSMLUP00000021209 ENSMLUP00000021209

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]