SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000021233 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000021233
Domain Number 1 Region: 30-204
Classification Level Classification E-value
Superfamily Clavaminate synthase-like 1.92e-18
Family AlkB-like 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000021233   Gene: ENSMLUG00000015076   Transcript: ENSMLUT00000015075
Sequence length 221
Comment pep:known_by_projection scaffold:Myoluc2.0:GL429982:193447:194112:-1 gene:ENSMLUG00000015076 transcript:ENSMLUT00000015075 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAGSGWLALRTMPGLGWVRGSGPAVLRRLQDAAVVWPGFLSGVEEETLTRELEPELRRCR
YEFDHWDAAIHGFRETEKSRWSEASRAILQRVQAAAFGPGQTLLSSVHVLDLEPRGYIKP
HVDSIKFCRTTIAGLSLLSTSVMRLVHTQEPGEWLELLLEPCSLYILRDSARYDFSHEIF
RDEESFFGKLRVPRGRRISVICRSLPEGVGPEEPGQPPPAC
Download sequence
Identical sequences G1QC00
ENSMLUP00000021233 XP_006098024.1.53796 ENSMLUP00000021233

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]