SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000021276 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000021276
Domain Number 1 Region: 58-320
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 1.83e-36
Family Voltage-gated potassium channels 0.0051
Further Details:      
 
Domain Number 2 Region: 383-516
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 6.94e-36
Family cAMP-binding domain 0.00000027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000021276   Gene: ENSMLUG00000030344   Transcript: ENSMLUT00000025125
Sequence length 1001
Comment pep:known_by_projection scaffold:Myoluc2.0:GL429808:4223017:4267924:-1 gene:ENSMLUG00000030344 transcript:ENSMLUT00000025125 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
XILPERPRCAWPGGFMQRQFGAMLQPGVNKFSLRMFGSQKAVEREQERVKSAGFWIIHPY
SDFRFYWDLTMLLLMVGNLIIIPVGITFFKDENTTPWIVFNVVSDTFFLIDLVLNFRTGI
VVEDNTEIILDPQRIKMKYLKSWFVVDFISSIPVDYIFLIVETRIDSEVYKTARALRIVR
FTKILSLLRLLRLSRLIRYIHQWEEIFHMTYDLASAVVRIVNLIGMMLLLCHWDGCLQFL
VPMLQDFPDDCWVSINNMVNSSWGKQYSYALFKAMSHMLCIGYGRQAPVGMSDVWLTMLS
MIVGATCYAMFIGHATALIQSLDSSRRQYQEKYRQSQAACGFSFLVPGHLHSVGHVEDRS
LGWSFSSTPAAGSQGHCLGHSGEQEIINFNCRKLVASMPLFANADPNFVTSMLTKLRFEV
FQPGDYIIREGTIGKKMYFIQHGVVSVLTKGNKETKLADGSYFGEICLLTRGRRTASVRA
DTYCRLYSLSVDNFNEVLEEYPMMRRAFETVALDRLDRIGKKNSILLHKVQHDLNSGVFN
YQENEIIQQIVQHDREMAHCAHRVQAATSATPTATPVIWTPLIQAPLQAAAATTSVAIAL
THHPRLPAAIFRPPPGPKLSSLGPGQTPRHLKRLQSLIPSALGSASPTSSPSQLDTPSSS
SFHIQQLAGFSAPAGLSPLLSSSSSSPLPGVCGSSPAPTLSANTASTTIAGFGLFHKALG
GSLSSSDSPLLTPLQPGTHSPQANQPLPSLPGAQGSLGLLEHFLPPPPSSRSPSSSPGQL
GQPPGELSPGLAAGPPSTPETPPRQPEQPSMAGASGEASPIAFTPRRGLSPPGHSPGPAR
TFPNAPPRASGSHGSLLLPPVSSPPPLQVPQRWGTPPLTPGRLTQDLKLISASQPALPQD
GAQTLHRASPHSSGESVAAFPLFPRAGGCSGGLGPPGRPYGAASGQHVTLPQKTSSGSLP
PPLCLFGARAASSGAPPLTAASQREPGARAEPVRSKLPSNL
Download sequence
Identical sequences G1QC43
ENSMLUP00000021276 ENSMLUP00000021276

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]