SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000021303 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000021303
Domain Number 1 Region: 60-168
Classification Level Classification E-value
Superfamily Bromodomain 7.98e-21
Family Bromodomain 0.0017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000021303   Gene: ENSMLUG00000026931   Transcript: ENSMLUT00000028753
Sequence length 239
Comment pep:novel scaffold:Myoluc2.0:GL429809:6791492:6792208:-1 gene:ENSMLUG00000026931 transcript:ENSMLUT00000028753 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
EKDHDEHKDRTQKKRKTKSRFKGETQKRVKEDRKKPDRDHVENEAEKDLQGQAPAGLDLP
PDKPPKLLRQTRSRTHTSLNQLMRQLQIKDPSAFFSFPVTDFIAPSYFMIINHPIDFSTM
KKTDYQSTELKDNFKLMCTDAMIYNKPGTTYYKAATKLLHSGVNILSQERIQSLTQSTDF
MAGLQKSRKQKDWTDTPQRGEEGSCWPPKGRTQARWEYKSLSSKEENKDKNVLEGKVKS
Download sequence
Identical sequences G1QC70
ENSMLUP00000021303 ENSMLUP00000021303

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]