SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000021418 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000021418
Domain Number 1 Region: 144-239
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 0.00000354
Family cAMP-binding domain 0.04
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000021418   Gene: ENSMLUG00000008070   Transcript: ENSMLUT00000026441
Sequence length 368
Comment pep:known_by_projection scaffold:Myoluc2.0:GL429851:2599429:2612746:-1 gene:ENSMLUG00000008070 transcript:ENSMLUT00000026441 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSANSSTLGQRLWQGPVCAGWKQDMEGALYHLANCVLLLGFMGGSGVYGCFYLFGFLGTG
YVCYVLWGWFNACGLDIVIWNFLLAMACLLQLAHLVYRLRKDTLPEEFDLLYKTLCVPLQ
VPMQAYKEIVRCCEEQVLTLATEQTYAVEGETPINRLSLLLSGRVRVSQDGQFLHYIFPY
QFMDSPEWESLPPSEEGVFQVTLTAETPCSYISWPRKSLHLLLAKERYISRLFSVLLGYD
ISEKLYALNEKLFAKFGLCFDIRLPSLYHVLGSAASDAGPESEKEDEEVHEPAPAPPQAM
PTPVQHMPPCSPLPAATHPPAQPSRARMSRPDSDGLGEDSTSLVLEDFEEVSGSESFMDY
RSDGEYMR
Download sequence
Identical sequences G1QCI5
ENSMLUP00000021418 ENSMLUP00000021418 XP_014313214.1.53796

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]