SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000021508 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000021508
Domain Number 1 Region: 327-584
Classification Level Classification E-value
Superfamily p53-like transcription factors 5.09e-98
Family STAT DNA-binding domain 0.0000648
Further Details:      
 
Domain Number 2 Region: 136-332
Classification Level Classification E-value
Superfamily STAT 4.12e-54
Family STAT 0.00015
Further Details:      
 
Domain Number 3 Region: 1-124
Classification Level Classification E-value
Superfamily Transcription factor STAT-4 N-domain 1.11e-39
Family Transcription factor STAT-4 N-domain 0.00033
Further Details:      
 
Domain Number 4 Region: 587-707
Classification Level Classification E-value
Superfamily SH2 domain 6.6e-34
Family SH2 domain 0.00022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000021508   Gene: ENSMLUG00000026308   Transcript: ENSMLUT00000030384
Sequence length 798
Comment pep:known_by_projection scaffold:Myoluc2.0:GL429867:1476625:1494900:-1 gene:ENSMLUG00000026308 transcript:ENSMLUT00000030384 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAGWIQAQQLQGDALRQMQVLYGQHFPIEVRHYLAQWIESQPWDAIDPENPQDQAQATQL
LEGLVQELQKKAEHQVGEDGFLLKIKLGHYATQLQNTYDRCPMELVRCIRHILYNEQRLV
REANNGASPVGMLVDAMSQKHLQINQTFEELRLVTQDTENELKKLQQTQEYFIIQYQESL
RIQAQFAQLAQLNPQERLSRESALQQKQVSLEAWLQREAQTLQQYRVELAEKHQKTLQLL
RKQQTIILDDELIQWKRRQQLAGNGGPPEASLDVLQSWCEKLAEIIWQNRQQIRRAEHLC
QQLPIPGPVEEMLAEVNATITDIISALVTSTFIIEKQPPQVLKTQTKFAATVRLLVGGKL
NVHMNPPQVKATIISEQQAKSLLKNENTRNECSGEILNNCCVMEYHQATGTLSAHFRNMS
LKRIKRADRRGAESVTEEKFTVLFESQFSVGSNELVFQVKTLSLPVVVIVHGSQDHNATA
TVLWDNAFAEPGRVPFAVPDKVLWPQLCDALNMKFKAEVQSNRGLTKENLVFLAQKLFNS
SSSHLEDYNSMSVSWSQFNRENLPGWNYTFWQWFDGVMEVLKKHHKPHWNDGAILGFVNK
QQAHDLLINKPDGTFLLRFSDSEIGGITIAWKFDSPDRNLWNLKPFTTRDFSIRSLADRL
GDLSYLIYVFPDRPKDEVFAKYYTPVLVPPSAAKAVDGYVKPQIKQVVPEFVTSADSAGG
NATYIEQAPSPAVGPQAHYNMYPQNPDPVLEQDVEFDLDETMDVARHVEELLRRPIDSLD
PRLSPPTGLFSSTRGSLS
Download sequence
Identical sequences G1QCS5
ENSMLUP00000021508 XP_006092434.1.53796 ENSMLUP00000021508

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]