SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000021516 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000021516
Domain Number 1 Region: 78-163
Classification Level Classification E-value
Superfamily HMG-box 2.36e-31
Family HMG-box 0.00000617
Further Details:      
 
Domain Number 2 Region: 3-80
Classification Level Classification E-value
Superfamily HMG-box 7.2e-24
Family HMG-box 0.00000898
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000021516   Gene: ENSMLUG00000026303   Transcript: ENSMLUT00000029875
Sequence length 207
Comment pep:known_by_projection scaffold:Myoluc2.0:GL429768:34234828:34236364:-1 gene:ENSMLUG00000026303 transcript:ENSMLUT00000029875 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGKGDPNKPRGKMSSYAFFVQCREEHKKKHPDSSVNFSEFSKKCSEKWKTMSAKEKSKFE
DMAKSDKARYDREMKNYVPPKGDKKGKKKDPNAPKRPPSAFFLFCSEHRPKIKSEHPGLS
IGDTAKKLGEMWSEQSAKDKQPYEQKAAKLKEKYEKDIAAYRAKGKSEVGKKGPGRPTGS
KKKNEPEDEEEEEEEDDDDEEEDEDEE
Download sequence
Identical sequences G1QCT3
ENSMLUP00000021516 ENSMLUP00000021516

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]