SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000021530 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000021530
Domain Number 1 Region: 257-343
Classification Level Classification E-value
Superfamily PH domain-like 0.000000000697
Family Ran-binding domain 0.00011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000021530   Gene: ENSMLUG00000024767   Transcript: ENSMLUT00000025745
Sequence length 400
Comment pep:known_by_projection scaffold:Myoluc2.0:GL430236:124781:126075:1 gene:ENSMLUG00000024767 transcript:ENSMLUT00000025745 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
HCSPVKRDRRSSFTQPGERISGFPLRSPTLIHGQAPRAGLQARSQGAAAEPASGEGLQPH
RKGPLRASQQQHQRARPLQVPPLPGSQPGLPAPPNGDQETRRQHLKREIPRNESSNTSEE
DNEKEQVAQQESVFGQNLKDKLINNNTEAAHRENAEHPSQKPIRDQLFPISSSLENSTNR
AEATCNAFVFGQKVSEHVGPTKLNAVTSDTTRENSCASQGLSATSRRPPEKESWTNQQLP
TPRQRKTSVAGKSGNDHQEETESNTLQIRCKLFVFGQGLLRPNDVASTGDWTLQSQLVRR
TRLIINTKLWAQMQIDKASEKSICFMAMHREDQGVDFLISASSMDAGRLCMWPSAARTPA
PSLVQPHSMGMTVTTMTLAPKGAIGGCTDYEGDRQTEGQE
Download sequence
Identical sequences G1QCU7
ENSMLUP00000021530 ENSMLUP00000021530

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]