SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000021531 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000021531
Domain Number 1 Region: 467-510,667-773
Classification Level Classification E-value
Superfamily PH domain-like 5.79e-22
Family Pleckstrin-homology domain (PH domain) 0.005
Further Details:      
 
Domain Number 2 Region: 99-363
Classification Level Classification E-value
Superfamily ARM repeat 0.0000000528
Family Regulatory subunit H of the V-type ATPase 0.071
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000021531   Gene: ENSMLUG00000000477   Transcript: ENSMLUT00000026601
Sequence length 787
Comment pep:known_by_projection scaffold:Myoluc2.0:GL429837:2061530:2246083:1 gene:ENSMLUG00000000477 transcript:ENSMLUT00000026601 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MHHLFRLVLGQKDLSRAGDLFSLDDSEIEDSLTEALEQIKIISSSSDYQTNNNDQAVVEI
CITRITTAIRETESIEKHAKALVGLWDSCLEHNLRPSGKDEDTPHAKIASDIMSCILQNY
NRPPVMALAIPIAVKFLHRSNKELCRNMSNYLSLAAITKADLLADHTEVIVKSILQGNTM
LLRVLPAVYEKQPQPINRHLTELLALMSQLEQPEQYHLLRLLHVAAKRKQPEVVQKCIPF
LIRHLKDSSHSDVILNILIEIAGYEPVALNSFLPMLREIGERFPYLIGQMARIYGAVGHV
DEERARSCLPFLVSQLANMEHSFHHILLLEIKSITDTFSSLLGPQSRDIFRMSNSFTAIA
KLLTRQLETTKPQSGRRKISTEIEFPEKLEETKLTAAENEDQKKLHVKIQAFEDKINAEI
NTPGSIRRYSLGQVSKEERKDIRFNRSKSLALHTVLTKGMSSDDGEVVERGDIPASISLS
EIDSLSQGNKSPFKADTDGSQLGNSSVSHPSIIHIESENLPETVKKNYQEETPETTVSPV
EYQDKLYLHLKKNLSKVKAYAVEIGKKIPVPDQCTIEDSVRSCVAKLFFTCSLKGHYCLY
SKSSFILISQEPQPWIQIMFLFQQDLDQVQLHLEEVRFFDVFGFSEAAGAWQCFMCNNPE
KAAVVNQDGQPLIEGKLKEKQVRWKFIKRWKTRYFTLAGNQLLFQKGKSKDDPDDSPIEL
SKVQSVKVVARKRRDRSLPRAFEIFTDNKTYVFKAKDEKNAEEWLQCINVAVAQAKERES
REVTTYL
Download sequence
Identical sequences G1QCU8
ENSMLUP00000021531

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]