SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000021586 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000021586
Domain Number 1 Region: 883-1231
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 6.32e-94
Family Phoshoinositide 3-kinase (PI3K), catalytic domain 0.000000967
Further Details:      
 
Domain Number 2 Region: 706-878
Classification Level Classification E-value
Superfamily ARM repeat 1.92e-45
Family Phoshoinositide 3-kinase (PI3K) helical domain 0.00059
Further Details:      
 
Domain Number 3 Region: 555-686
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 3.57e-19
Family PLC-like (P variant) 0.038
Further Details:      
 
Domain Number 4 Region: 1262-1367
Classification Level Classification E-value
Superfamily PX domain 1.7e-18
Family PX domain 0.0038
Further Details:      
 
Domain Number 5 Region: 1396-1500
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 0.000000000000586
Family Synaptotagmin-like (S variant) 0.011
Further Details:      
 
Domain Number 6 Region: 239-348
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.0000062
Family Ras-binding domain, RBD 0.059
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000021586   Gene: ENSMLUG00000017194   Transcript: ENSMLUT00000027101
Sequence length 1503
Comment pep:known_by_projection scaffold:Myoluc2.0:GL429777:15749099:15996771:1 gene:ENSMLUG00000017194 transcript:ENSMLUT00000027101 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAYCWKTDLNPSESHEEQHEHQELHSVNPPPSSSQLSLGFDQLVDEINNKIPFYQREIEE
NTVSVPSSPKHSLDEAQQISLNEFNSKSSELSCHQVRKTPVIGFRPSALPNPQNINKESS
GRNPTGKHHGADVYRFDISAPSSASLDQINSQTELENKNPNYHIGFERSIPPIYPSFSTD
FMPKEENKRKRNANTVEPSSMLFKGSLLPRMCDSSWPKDIEMTGCSIQLIEVPEGSNMTL
ASFCDKVKKIRETYHAADINSNSGKIWSTATAFPYQLFSNTKFSINIFIGDSTQLLHFMP
HANYLVKDLIAEILHFWTNDQLFHKDYLLSICGYEEFLQNDRSLGSHKIFQKDKSVIQLN
LQNNREAPGKLSRKHEDDHSPFFLNQLLEFMHIWKISRQCLSTIIKKYDSHLKYLLKTQD
LKDIFDKAHCFFFSSSPHKARQNVESIIEEVKNICSVLGCVETKQITDAVNKLNLILQRK
SESFHQNSETPAKGWIEKVTTELSTSIYQLIDVYCNSFYTDFQPLNTAVSVSCVNPGLHP
HLSFTVYAAHNIPEAWVHGYKAFSFSCWLTYAGKKLFQVRNYKNIPVKKLFFFLVNWNET
ITFPLEIKSLPKESMLTIKLFGINCATNNAEILAWTSLPLFPKDKIILGSVLFSMTLHSE
PPIEIIAPGVWDISQPSPVILQIDFPATEWEYVKLDVEDSRSNLEEPPKECLKHIARLSQ
KQSPLLLSEEKRRYLWFYRFYCNNENCSLPLVLGSAPGWDERTTSEMHSILRRWKFSHPL
EALGLLTSSFPDQEIRKVAVQQLDNLLNDELLDYLPQLVQAVKFEWNLESPLVQLLLHRS
LQSIQIAHRLYWLLKDAQNEAYFKSWYQKLLAALQFCAGKALSDEFSKEMKLIEILGGIG
EKVKSASELQRQDVLKKEIGRLEEFFQSIHTCHLPLNPAVCIKGIDHKACSYFTSNALPL
KITFINANPMGKNISIIFKAGDDLRQDMLVLQIVQMMDNIWLQEGLDMQMIIYRCLSTGK
GQGLVQMVPDAVTLAKIHRHAGLMGPLKENTIKKWFSQHNHLKADYEKALSNFFYSCAGW
CVVTFILGVCDRHNDNIMLTKSGHMFHIDFGKILGHAQTFGGIKRDRAPFIFTSEMEYFI
TEGGKNPQHFQDFVELCCRAYNIVRRHSQLLLNLLEMMLHAGLPELSGIQDLKYVYNNLR
PQDTDLEATSHFTKKIKESLECFPVKLNNLIHTLAQMTAISPAKCTSQNFPRESCLPSAT
RSIQRAAILRFSNRTSPLYLIQVTHNNNETSLTEKSFEQFSKLHSQLQKQFASLTLPEFP
HWWHLPFTDSDHKRFRDLNHYMEQILTGSYEIANSDCVLEFFLSEPVQQTLEESSPLFLG
EMFPDKVPKVQLVITYEDVKLTILVKHMKNIHLPDGSAPSAHVEFYLLPYPSEVRRRKTK
SVPKCTDPTYNEIVVYDEVTELQGHVLMLIVKSKATFVGAINIQLCNVPLNEEKWYPLGN
SII
Download sequence
Identical sequences G1QD03
ENSMLUP00000021586 ENSMLUP00000021586

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]