SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000021628 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000021628
Domain Number 1 Region: 2-41
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.0000000019
Family Ubiquitin-related 0.00049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000021628   Gene: ENSMLUG00000028221   Transcript: ENSMLUT00000025541
Sequence length 340
Comment pep:novel scaffold:Myoluc2.0:AAPE02065600:1751:8109:1 gene:ENSMLUG00000028221 transcript:ENSMLUT00000025541 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RPEDQRLIYSGKLLLDNQYLRDLLPKQETRHVLHLVCSVKSPSKMPETSAKVAESTEQPA
GPTQGQYPGDSSSDGVRLREPLRNLSPSGWENISRPEAAQPAFQGLGPGFSGYTTYGWLQ
LSWFQQIYARQYYMQYLAATAASGTFVPSPSAQEIPVVSAPAPAPIHNQFPAENQPANQN
AAPQVVVNPGANQNLRMNAQGGPLVEEDDEINRDWLDWTYSAATFSVFLSILYFYSSLSR
FLMVMGATVVMYLHHVGWFPFRQRPVQNFPNDRPRPEAANQDPNNNLQEGPEAEIGNPNR
LPDRNVVDGEQSLSFMSTAWLVFKTFFASLLPEGPPAIAN
Download sequence
Identical sequences G1QD45
ENSMLUP00000021628 ENSMLUP00000021628

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]