SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000021712 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000021712
Domain Number 1 Region: 3-128
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 6.28e-48
Family Regulator of G-protein signaling, RGS 0.00001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000021712   Gene: ENSMLUG00000028811   Transcript: ENSMLUT00000023013
Sequence length 133
Comment pep:known_by_projection scaffold:Myoluc2.0:GL429900:3717245:3727607:1 gene:ENSMLUG00000028811 transcript:ENSMLUT00000023013 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
EAAAWSENMDTLLTNQAGLDAFRTFLKSEFSEENVEFWLACEDFKKTENAEKIASKAKMI
YSEFIEADAPKEINIDFSTRDLISRNIAEPTLKCFDEAQKLIYSLMAKDSFPRFLKSEIY
KKLVNSKQQILKI
Download sequence
Identical sequences G1QDC9
ENSMLUP00000021712 ENSMLUP00000021712

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]