SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000021744 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000021744
Domain Number 1 Region: 21-225
Classification Level Classification E-value
Superfamily Clavaminate synthase-like 7.69e-31
Family AlkB-like 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000021744   Gene: ENSMLUG00000030420   Transcript: ENSMLUT00000030655
Sequence length 236
Comment pep:known_by_projection scaffold:Myoluc2.0:GL430011:972750:976746:1 gene:ENSMLUG00000030420 transcript:ENSMLUT00000030655 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SEDQDSRVPALEPFRVEQAPPVIYYVPDFISKEEEEYLLRQVFNAPKPKWTQLSGRKLQN
WGGLPHPRGMVPERLPLWLQRYVDKVSDLNLFGGLPANHVLVNQYLPGEGIMPHKDGPLY
YPTVSTISLGSHTMLDLYEPRQPKDEDPTEQPAPPGRPPSLLLEPRSLLVLRGAYTHLLH
GTSGLCRSTRHGLSTAQRCPQGPSARPGAHLVRGTRVSLTIRRVPRVLRAGLLLSK
Download sequence
Identical sequences G1QDG1
ENSMLUP00000021744 ENSMLUP00000021744

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]