SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000021837 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000021837
Domain Number 1 Region: 260-510
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 6.26e-35
Family Protein kinases, catalytic subunit 0.00043
Further Details:      
 
Domain Number 2 Region: 26-134
Classification Level Classification E-value
Superfamily Ankyrin repeat 8.71e-21
Family Ankyrin repeat 0.0011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000021837   Gene: ENSMLUG00000006171   Transcript: ENSMLUT00000029870
Sequence length 1444
Comment pep:known_by_projection scaffold:Myoluc2.0:GL429925:2640739:2701144:-1 gene:ENSMLUG00000006171 transcript:ENSMLUT00000029870 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSRAVQLPVPCPVRLGSLKGDSLEAQLHEYVREGSYLKVKKILKKGIYVDAVNSLGQTPL
FLASLLGLTKLVDILVDYGSDPNHRCFDGSTPVHAAAFSGNQWILSKVLDAGGDLRLHDE
KGQSPQAWALTAGKECSTMMVEFMHRCASHMQAVVQDFSCDLLKKVDSTERLICSLPRFG
GLMQGSPNGPSKRPRKTGVISAQNIHSFGFGKFCLSARTRVTYLGSLPIIGEKEIIQADD
EPAFSFCSGPYMVMTNLVWKGSRVTVKELHLPTHPHCSKLRLADLLIAEQEHSSKLRHRH
LLQLMAVCLSQDLEKTRLVYERITIGTLFSVLHERRSEFPLLHMEEIVHLLLQISDALRY
LHSWGFIHRALSSYAIHIISTWEARLTNLEYMLESQDRDVHRDLTRVPLPAQLYRWAAPE
VILQKEVTVKSDVYSFSVIIQEILTDNIPWDGLDGSVIKRAIVVGNYLEADFRLPKPYYD
IVKSGIQVRQKDRTLNLQDIQYILKNDLKELIGAQRTQPTESPRVQRYERHPDVGVYLGL
TSEHLKENPDLEIKELKEAGIQLHSSRNPSEKATPDPQVPDPSLMAKEAQRQDAAPPACF
VARSPSSELSSLCSFEMNEIYSRCLDTEGDKEKEPPGVGLSLEGASQNQGGELASLEEEL
EKMEREACCFCEKSESSSEADTEVSFEDWDQQNGSLSSPSPPKPAREAKCKVSKWSKTDM
YISKCILDVKIAQAMANQNNEKIKQKFNEYERRLKEQEECMSLWASSRMFPNLSHLPAAV
GPPSSVYIPPVLPSQRPDAGGNCPTLARSPRTVRDFQGEHFGRRSRGRSSCDWKPFTAFI
QVSEESTGDSSEKSHQLLTLCGPGEQSPGEQFPPTQGARDSPEGNRNQNTCRINMESVSS
EIYNTKSRNNDVGKGHLKWKMEVKKMAEKAAAGQLAVPPWHPQSGSTLENEAEAENEPDP
LLQPPIRDAENVTWRRVVEYSRESAPGGTGKRDKTDSGDHEDDQRGRQPGSFPSVSHPSP
RKSEEPEHSEVFQARSEASVVTEKSCNTSSPIEEDFEGMQEAFARCPVSGEGKVQTRQSF
GKDAEVLTRSQFQPIQSPEGEQEETLKESPKELKEKDISLTDIQDLSSISYEQDASFKEV
SCKTPRINHALPSVSTPLSPAESISSSDSHYKDCLESFTFQDKTGSTSCWSYQESTLSDK
FTTVQEKVKSLESLFASSETLPSRLTDHKRSSTFTRTGSSRSAKVPDKSSLAIQKRSLPR
ELIEAISQHHIDKLPPPSQELLDEIEHLKRQQASSAVLGEDPANPLGVTAKDQSHLEEQE
TSSTKEDSSVLWTQETQGLEEDTERAHSSLDEDLERWLQPPEDITVLQDLPKGSARETDT
KDQEVGEKKRKVEEGMKPERTSESFLGASKEEELKSCFGKRLSWSEPSRNTHRIIVLDQS
DLSD
Download sequence
Identical sequences G1QDQ4
ENSMLUP00000021837

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]