SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000021854 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000021854
Domain Number 1 Region: 29-76
Classification Level Classification E-value
Superfamily Elafin-like 0.0000000000942
Family Elafin-like 0.0031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000021854   Gene: ENSMLUG00000026345   Transcript: ENSMLUT00000030616
Sequence length 80
Comment pep:novel scaffold:Myoluc2.0:GL431840:301:543:1 gene:ENSMLUG00000026345 transcript:ENSMLUT00000030616 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKLSSLCVLTGALLLLLGPHAARPGPTRAADKPGYCPEFSPHCPFTMLPTCWRDRGCRKA
KKCCFYNCRRQCMEPWWSLD
Download sequence
Identical sequences G1QDS1
ENSMLUP00000021854 ENSMLUP00000021854

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]