SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000021898 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000021898
Domain Number 1 Region: 266-341
Classification Level Classification E-value
Superfamily SH3-domain 0.000000000000116
Family SH3-domain 0.0017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000021898   Gene: ENSMLUG00000025131   Transcript: ENSMLUT00000025521
Sequence length 405
Comment pep:known_by_projection scaffold:Myoluc2.0:GL429773:3124075:3134682:-1 gene:ENSMLUG00000025131 transcript:ENSMLUT00000025521 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
ANQQPPPMHQAYNKRAIPPTSVRIPCTGPLFRSADLGPTLLTRPGQPALTRVPPPILPRP
SHQTGSSSVNTFRPAYSSFSSGYGAYGNSFYGSYSPYSYGYNGLNYNRLRVDDLPPSRFV
QQAEESSRGAFQSIESIVHAFASVSMMMDATFSAVYNSFRAVLDVANHFSRLKIHFTKVF
SAFALVRTIRYLYRRLQQMIGLRRGSENEDLWAESERTVACLGADDRAANSAKSWPIFLF
FAVILGGPYLIWKLLSTHSDEITDNTNWASGEDDHVVARAEYDFAALSEEEISFRAGDML
NLALKAEQQPRVRGWLLASLDGQTTGLIPANYVKILGKRRGRKTLESSKISKQQQPLTNT
TLIKGATAADSLDEQEAAFESVFVETSKVPVVPSSTGISGDKQDL
Download sequence
Identical sequences G1QDW5
ENSMLUP00000021898 ENSMLUP00000021898

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]