SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000022013 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000022013
Domain Number 1 Region: 278-434
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 5.54e-36
Family SPRY domain 0.00061
Further Details:      
 
Domain Number 2 Region: 7-78
Classification Level Classification E-value
Superfamily RING/U-box 1.13e-18
Family RING finger domain, C3HC4 0.019
Further Details:      
 
Domain Number 3 Region: 85-147
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 0.000000000000473
Family B-box zinc-binding domain 0.0025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000022013   Gene: ENSMLUG00000028724   Transcript: ENSMLUT00000006776
Sequence length 450
Comment pep:known_by_projection scaffold:Myoluc2.0:GL429773:16099236:16100834:-1 gene:ENSMLUG00000028724 transcript:ENSMLUT00000006776 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDSNLPENFQKELTCAICLNYFIDPVTMGCGHSCCCSCLYVSWEKAESPTCPVCREPSEQ
KNFKTNIVLKNLVSMARKASLWQFLSSEDNRCGLHKEAKQIFCEDNRSLLCLHCSSSQEH
EAHRHCSVEEAVEEHRRKLSNQMRSLWEKIQEIQKNLSKDGRIPVYWMTYLYRRQDETRA
FYEALQLVLHEKDKQNLEILIKEGSKLSGQLEKRQAEMIEKRISLRAMYDELMDMRLKPD
VEMLKELGDKLRRSEQVQLHMPQPLQPEFPARPITRLMRRLNCFRVEVSFTGEITHDNIR
LFDDVRSLRFMRDGPHVSLDPGASNCFAAWGAQVFNSGKRYWEVNVDKSWDWAVGVCRDS
WMKKNGTLTESKDTFLLIHVKEDNHTTLWTTAPMAPQYIQKPLGRVGVFLDIDNGSVSFV
DVARCSLINSHPSLCPHSPPTVLIHRCTIF
Download sequence
Identical sequences G1QE80
ENSMLUP00000022013 ENSMLUP00000022013

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]